Your cart is ready — click here to view your products.

FREE EXPRESS SHIPPING FOR ORDERS OVER $400

New Year Sale Ends
:
:
:

Sema (GLP-1) (10mg / 15mg / 20mg)

Sema (GLP-1) (10mg / 15mg / 20mg)

150 sold this week

Sema (GLP-1 receptor agonist) is examined in glycemic control, appetite regulation and cardiometabolic research models.
Now $158
$190
Now

Product Options:

  • Buy More Icon Buy more, get it as low as $126
  • Free Shipping Icon Free Shipping Over $400
Description
 

Semagltuide (GLP-1) (5mg / 10mg)
GLP-1 Analog for Metabolic, Endocrine, and Appetite Regulation Research

Semagltuide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist engineered to mimic the activity of endogenous GLP-1. This compound is commonly utilized in metabolic research studies exploring insulin secretion, glucose regulation, and appetite signaling pathways. Its extended half-life and receptor specificity make it suitable for sustained experimental modeling in metabolic disease frameworks.

Product Overview
Available in 5mg and 10mg lyophilized vials, Semagltuide is synthesized at >99% purity. It is widely applied in in vitro research examining obesity mechanisms, pancreatic beta cell function, and gastrointestinal hormonal feedback. The compound's high receptor affinity and slow degradation support long-term cellular studies.

Key Research Attributes:

  • GLP-1 Receptor Agonism: Semagltuide binds to GLP-1 receptors to modulate insulin release, appetite signaling, and energy expenditure.
  • Metabolic Disorder Research: Extensively used in lab settings studying type 2 diabetes, obesity, and insulin resistance.
  • Gastric Emptying and Satiety: Investigated for its role in slowing digestion and increasing feelings of fullness in gut-brain axis models.
  • High Purity Standard: Lab-tested for superior consistency and performance in controlled in vitro studies.


Applications in Scientific Research

  • GLP-1 receptor signaling pathway studies
  • In vitro diabetes and insulinotropic activity assays
  • Obesity and appetite regulation models
  • Pancreatic beta cell survival and proliferation studies
  • Energy homeostasis and gastrointestinal hormone feedback mechanisms

Format and Storage
Form: Lyophilized powder
Purity: >99%
Storage: Store at -20°C in a moisture-free environment
Reconstitution: Reconstitute with sterile bacteriostatic water in a sterile lab environment

Disclaimer: Semagltuide (GLP-1) (5mg / 10mg) is supplied exclusively for scientific and in vitro research use. It is not for human or veterinary application. All usage must comply with institutional guidelines and local laws.



Chemical Makeup

Molecular Formula

  • Semagltuide: C187H291N45O59

Molecular Weight

  • Semagltuide: 4113.6 g/mol

Sequence

  • Semagltuide: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Other Known Titles

  • Semagltuide: GLP-1 Receptor Agonist, NN9535
 

Semagltuide (GLP-1) (5mg / 10mg) is intended for licensed scientific research only. All orders are subject to our Terms and Conditions.

More Information
Purity Percentage 99% Purity
Volume 10MG
Bought This Week 150
New No
Sale No
Research

Semagltuide Research: Effects, Benefits, and Side Effects

Semagltuide is a GLP-1 like peptide 1 receptor agonist investigated for its effects on blood glucose control, body weight regulation, and cardiometabolic risk. It is best known from type 2 diabetes and obesity research, with additional data emerging in kidney, cardiovascular, and long term outcome studies. The sources below outline proposed benefits, mechanisms of action, and reported side effects, including both common and rare events.

  • •
    Semagltuide | Reviews, Clinical Data, and Benefits
    Overview of mechanism of action, clinical trial outcomes, metabolic effects, and reported side effects.
    Read more
  • •
    Effects of Semagltuide on Chronic Kidney Disease in Type 2 Diabetes
    Summarises renal function outcomes and slowed chronic kidney disease progression in clinical models.
    Read more
  • •
    Rare but Serious Adverse Effects Emerging with Semagltuide
    Discusses emerging post market findings on rare gastrointestinal and biliary adverse events.
    Read more
  • •
    Health Benefits of Semagltuide — Beyond Weight Loss
    Reviews additional data on cardiovascular risk reduction and possible neuroprotective effects.
    Read more
  • •
    Adverse Effects: Systematic Review and Meta Analysis Protocol
    Outlines methodology for evaluating adverse events across multiple trial environments.
    Read more
  • •
    Heart Health Improvement and Weight Reduction Effects
    Summarises cardiovascular outcomes and obesity related data from controlled studies.
    Read more
  • •
    Four Year Obesity Study Findings
    Long term outcome data on weight management, glycemic markers, and tolerability.
    Read more
  • •
    How Semagltuide Works: Mechanism, Administration and Safety
    Practical overview covering pathways, injection methods, side effects, and general cost considerations.
    Read more
  • •
    Reduction in Major Cardiovascular Event Risk
    Reviews clinical trial evidence on reduced event rates in high risk populations.
    Read more
Certificate of Analysis
FAQs
What is a pre-order?
A pre-order occurs when we have incoming stock that has not yet reached our fulfilment centres. You can still order these products and we will ship as soon as stock arrives. This is usually on, or close to the specified date on the product page.
How does shipping and delivery work?
Orders usually ship within 24 hours. Once your order has shipped, you’ll receive an email with tracking details so you can keep a close eye on your order until it reaches its destination.

Please note if you order multiple items in a single order, items may ship from multiple locations depending on stock availability. We do this to ensure you receive your full order as fast as possible.

Delivery timeframes vary depending on your location and do not include dispatch times. If you select express shipping, you can expect your order to arrive within 1 to 3 business days after dispatch. Choose standard shipping and you can expect your order to arrive within 2 to 8 business days after dispatch. Express shipping is free for all orders over $200
Can I change my shipping address?
If your order was placed within the last 90 minutes, you can update your delivery address, email, or other personal information by clicking the link here. Enter your email address and order number to make the necessary changes.

If more than 90 minutes have passed since placing your order, please reach out to us at admin@peptidecentre.com. Our consultants will review your request.

Please note that our orders are processed quickly at our fulfillment center, so while flexibility may be limited, we’ll do our best to assist you.