Sale!

Semaglutide (Ozempic) (GLP-1) (5mg / 10mg)

As low as $3,032.79 was $3,641.79 Save $609.00
  • Buy More Icon Buy more, get it as low as $2,426.23
  • Free Shipping Icon Free Shipping Over $200
As low as $3,032.79 was $3,641.79 Save $609
Quantity Discount Price
5 - 8 10% $2,729.51 - $5,031.51
9 + 20% $2,426.23 - $4,472.45

Research Benefits:

  • Glycemic Regulation Studies: Semaglutide (GLP-1 receptor agonist) is widely studied for its role in enhancing glucose-dependent insulin secretion and improving glycemic control in metabolic research models.
  • Appetite & Weight Modulation: Frequently used in research examining appetite regulation, satiety signals, and caloric intake modulation through central nervous system pathways.
  • Cardiometabolic Health: Explored for its potential to lower blood pressure, reduce inflammation, and improve lipid profiles in long-term metabolic health studies.
  • Insulin Sensitivity & Beta Cell Function: Semaglutide is used to assess pancreatic beta cell preservation, insulin secretion, and resistance mitigation in diabetic research models.
  • High-Purity Peptide: Manufactured to >99% purity, this GLP-1 analog is ideal for laboratory and preclinical trials focused on obesity, diabetes, and cardiovascular risk reduction research.

Money Back
Gaurantee

Satisfaction
Guarantee

Same Day
Shipping

99%
Purity

Premium
Quality

Third Party
Tested

 

Semaglutide (Ozempic) (GLP-1) (5mg / 10mg)
GLP-1 Analog for Metabolic, Endocrine, and Appetite Regulation Research

Semaglutide is a long-acting glucagon-like peptide-1 (GLP-1) receptor agonist engineered to mimic the activity of endogenous GLP-1. This compound is commonly utilized in metabolic research studies exploring insulin secretion, glucose regulation, and appetite signaling pathways. Its extended half-life and receptor specificity make it suitable for sustained experimental modeling in metabolic disease frameworks.

Product Overview
Available in 5mg and 10mg lyophilized vials, Semaglutide is synthesized at >99% purity. It is widely applied in in vitro research examining obesity mechanisms, pancreatic beta cell function, and gastrointestinal hormonal feedback. The compound's high receptor affinity and slow degradation support long-term cellular studies.

Key Research Attributes:

  • GLP-1 Receptor Agonism: Semaglutide binds to GLP-1 receptors to modulate insulin release, appetite signaling, and energy expenditure.
  • Metabolic Disorder Research: Extensively used in lab settings studying type 2 diabetes, obesity, and insulin resistance.
  • Gastric Emptying and Satiety: Investigated for its role in slowing digestion and increasing feelings of fullness in gut-brain axis models.
  • High Purity Standard: Lab-tested for superior consistency and performance in controlled in vitro studies.


Applications in Scientific Research

  • GLP-1 receptor signaling pathway studies
  • In vitro diabetes and insulinotropic activity assays
  • Obesity and appetite regulation models
  • Pancreatic beta cell survival and proliferation studies
  • Energy homeostasis and gastrointestinal hormone feedback mechanisms

Format and Storage
Form: Lyophilized powder
Purity: >99%
Storage: Store at -20°C in a moisture-free environment
Reconstitution: Reconstitute with sterile bacteriostatic water in a sterile lab environment

Disclaimer: Semaglutide (Ozempic) (GLP-1) (5mg / 10mg) is supplied exclusively for scientific and in vitro research use. It is not for human or veterinary application. All usage must comply with institutional guidelines and local laws.



Chemical Makeup

Molecular Formula

  • Semaglutide: C187H291N45O59

Molecular Weight

  • Semaglutide: 4113.6 g/mol

Sequence

  • Semaglutide: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Other Known Titles

  • Semaglutide: Ozempic, GLP-1 Receptor Agonist, NN9535
 

Semaglutide (Ozempic) (GLP-1) (5mg / 10mg) is intended for licensed scientific research only. All orders are subject to our Terms and Conditions.

Research

Semaglutide Research: Effects, Benefits, and Side Effects

  • “Semaglutide | Reviews, Clinical Data, and Benefits”
    This article offers an in-depth review of semaglutide, including its mechanism of action, clinical trial outcomes, benefits in glycemic control and weight management, and potential side effects. Read more
  • “Effects of Semaglutide on Chronic Kidney Disease in Patients with Type 2 Diabetes”
    Published in Kidney International Reports, this study examines the impact of semaglutide on chronic kidney disease progression in individuals with type 2 diabetes, highlighting its renal benefits. Read more
  • “As Semaglutide’s Popularity Soars, Rare but Serious Adverse Effects Are Surfacing”
    An article from JAMA discussing the increasing use of semaglutide, its efficacy, and emerging reports of rare but serious adverse effects, emphasizing the importance of monitoring. Read more
  • “Health Benefits of Semaglutide — Beyond Weight Loss”
    This Mayo Clinic article explores additional health benefits of semaglutide, such as cardiovascular risk reduction and potential neuroprotective effects, along with a discussion of side effects. Read more
  • “Adverse Effects with Semaglutide: A Protocol for a Systematic Review with Meta-Analysis and Trial Sequential Analysis”
    A BMJ Open protocol outlining a systematic review aimed at investigating the adverse effects of semaglutide across various patient groups, providing a framework for future research. Read more
  • “Semaglutide Improves Heart Health and Reduces Weight in Obese Patients, but with Side Effects”
    An article from News-Medical.net reporting on studies that show semaglutide’s efficacy in weight reduction and cardiovascular health improvement, while also addressing associated side effects. Read more
  • “Semaglutide Shows Significant Weight Loss and Health Benefits in Four-Year Obesity Study”
    This News-Medical.net piece discusses long-term studies indicating substantial weight loss and health benefits from semaglutide use over four years, along with considerations of side effects. Read more
  • “New Study Finds Semaglutide Safe for Brain Health with Possible Benefits for Cognition and Nicotine Dependence”
    A report from the University of Oxford highlighting research that suggests semaglutide is safe for brain health and may offer cognitive benefits and aid in reducing nicotine dependence. Read more
  • “Semaglutide: How it Works, Injection, Side Effects, Cost”
    An article from Diabetes.co.uk providing a comprehensive overview of semaglutide, including its mechanism, administration methods, side effects, and cost considerations. Read more
  • “Semaglutide Reduces the Absolute Risk of Major Cardiovascular Events”
    A BMJ article presenting findings from clinical trials that demonstrate semaglutide’s effectiveness in reducing the risk of major cardiovascular events in patients with cardiovascular disease. Read more

Semaglutide Research: Effects, Benefits, and Side Effects

  • “Semaglutide | Reviews, Clinical Data, and Benefits”
    This article offers an in-depth review of semaglutide, including its mechanism of action, clinical trial outcomes, benefits in glycemic control and weight management, and potential side effects. Read more
  • “Effects of Semaglutide on Chronic Kidney Disease in Patients with Type 2 Diabetes”
    Published in Kidney International Reports, this study examines the impact of semaglutide on chronic kidney disease progression in individuals with type 2 diabetes, highlighting its renal benefits. Read more
  • “As Semaglutide’s Popularity Soars, Rare but Serious Adverse Effects Are Surfacing”
    An article from JAMA discussing the increasing use of semaglutide, its efficacy, and emerging reports of rare but serious adverse effects, emphasizing the importance of monitoring. Read more
  • “Health Benefits of Semaglutide — Beyond Weight Loss”
    This Mayo Clinic article explores additional health benefits of semaglutide, such as cardiovascular risk reduction and potential neuroprotective effects, along with a discussion of side effects. Read more
  • “Adverse Effects with Semaglutide: A Protocol for a Systematic Review with Meta-Analysis and Trial Sequential Analysis”
    A BMJ Open protocol outlining a systematic review aimed at investigating the adverse effects of semaglutide across various patient groups, providing a framework for future research. Read more
  • “Semaglutide Improves Heart Health and Reduces Weight in Obese Patients, but with Side Effects”
    An article from News-Medical.net reporting on studies that show semaglutide’s efficacy in weight reduction and cardiovascular health improvement, while also addressing associated side effects. Read more
  • “Semaglutide Shows Significant Weight Loss and Health Benefits in Four-Year Obesity Study”
    This News-Medical.net piece discusses long-term studies indicating substantial weight loss and health benefits from semaglutide use over four years, along with considerations of side effects. Read more
  • “New Study Finds Semaglutide Safe for Brain Health with Possible Benefits for Cognition and Nicotine Dependence”
    A report from the University of Oxford highlighting research that suggests semaglutide is safe for brain health and may offer cognitive benefits and aid in reducing nicotine dependence. Read more
  • “Semaglutide: How it Works, Injection, Side Effects, Cost”
    An article from Diabetes.co.uk providing a comprehensive overview of semaglutide, including its mechanism, administration methods, side effects, and cost considerations. Read more
  • “Semaglutide Reduces the Absolute Risk of Major Cardiovascular Events”
    A BMJ article presenting findings from clinical trials that demonstrate semaglutide’s effectiveness in reducing the risk of major cardiovascular events in patients with cardiovascular disease. Read more
Sign up as an Affiliate today!
Earn 20% On Every Sale! Start Making Money
With Your Friends - Join Now!

Earn money by becoming an affiliate, product offers and keep up to date with the latest news within the research chemicals space!